General Information

  • ID:  hor005385
  • Uniprot ID:  P68989
  • Protein name:  Insulin B chain
  • Gene name:  ins
  • Organism:  Oncorhynchus gorbuscha (Pink salmon) (Salmo gorbuscha)
  • Family:  insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AAAQHLCGSHLVDALYLVCGEKGFFYNPK
  • Length:  29(1-29)
  • Propeptide:  AAAQHLCGSHLVDALYLVCGEKGFFYNPKGIVEQCCHKPCNIFDLQNYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P68989-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005385_AF2.pdbhor005385_ESM.pdb

Physical Information

Mass: 365228 Formula: C144H215N37O39S2
Absent amino acids: IMRTW Common amino acids: AL
pI: 7.41 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 12
Hydrophobicity: 24.14 Boman Index: -547
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 87.59
Instability Index: 919.31 Extinction Coefficient cystines: 3105
Absorbance 280nm: 110.89

Literature

  • PubMed ID:  2184990
  • Title:  Amino acid sequence of humpback salmon (Oncorhynchus gorbuscha) insulin.